CD32 Rabbit monoclonal antibody

Size

POA

SKU:: A26173
Additional Names:: CD32|F630109E10Rik|Fc[g]RII|Fcgr2|Fcgr2a|FcgRII|Fcr-2|Fcr-3|fcRII|Ly-17|Ly-m20|LyM-1
Application:: ELISA, Flow Cytometry, WB, IHC-P
Molecular Weight:: 40-80 kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSR
Uniprot:: P08101
Synonyms:: AI528646;CD32;CD32B;CDw32;F630109E10Rik;Fc fragment of IgG, low affinity II, receptor for (CD32);Fc fragment of IgG, low affinity IIb, receptor (CD32);Fc fragment of IgG, low affinity IIb, receptor for (CD32);Fc gamma receptor IIb;Fc gamma RIIb;fc-gamma RII;fc-gamma RII-b;Fc-gamma RII-c;Fc-gamma-RII;fc-gamma-RIIb;Fc-gamma-RIIc;Fc[g];Fc[g]RII;Fcg;FCG2;Fcgamm;FcgammaRIIB;Fcgr;FCGR2;Fcgr2a;FCGR2C;FcgRII;Fcr-;Fcr-2;Fcr-3;fcRII;fcRII-b;FcRII-c;IGFR2;igG Fc receptor II beta;igG Fc receptor II-b;IgG Fc receptor II-c;low affinity immunoglobulin gamma Fc region receptor II;low affinity immunoglobulin gamma Fc region receptor II-b;Low affinity immunoglobulin gamma Fc region receptor II-c;Ly-1;Ly-17;Ly-m2;Ly-m20;LyM-;LyM-1;lymphocyte antigen 17
Extra Details:: CD32 (Fcgr2) is a 40 kD transmembrane glycoprotein, member of the immunoglobulin superfamily. The extracellular region of CD32 consists of two Ig C-type domains that binds the Fc region from monomeric IgG with low affinity, but binds immune complexes efficiently. CD32 can mediate phagocytosis of immune complexes and modulate cell activation. CD32 is expressed by Macrophages, neutrophils, mast cells and B cells.

Shipping Conditions:: Blue Ice