A26169
FRA1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A26169
- Additional Names:
- FRA|fra-1|FRA1
- Application:
- ELISA, WB
- Molecular Weight:
- 40 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQI
- Uniprot:
- P15407
- Synonyms:
- FOS like 1, AP-1 trancription factor subunit;FOS-like antigen-1;fos-related antigen 1;FRA;fra-1;FRA1
- Extra Details:
- The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice