A26154
ZNF683 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A26154
- Additional Names:
- Hobit,ZNF683
- Application:
- ELISA, WB
- Molecular Weight:
- 57kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- HSGARPFQCSVCRSRFTQHIHLKLHHRLHAPQPCGLVHTQLPLASLACLAQWHQGALDLMAVASEKHMGYDIDEVKVSSTSQGKARAVSLSSAGTPLVMGQDQNN
- Uniprot:
- Q8IZ20
- Synonyms:
- Hobit;homolog of Blimp-1 in T cells;homolog of Blimp-1 in T-cell;hypothetical protein MGC33414;tissue-resident T-cell transcription regulator protein ZNF683;Zinc finger protein 683
- Extra Details:
- Enables RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in T cell receptor signaling pathway; cellular response to ionomycin; and regulation of gene expression. Predicted to be located in nucleus.
- Shipping Conditions:
- Blue Ice