CD123 Rabbit monoclonal antibody

Size

POA

SKU:: A26137
Additional Names:: CD123|CDw123|SUT-1
Application:: ELISA, Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVK
Uniprot:: P26952
Synonyms:: CD123;CD123 antigen;CDw123;hIL-3Ra;Il-3 alpha subunit;IL-3 receptor alpha chain;IL-3 receptor subunit alpha;IL-3R subunit alpha;IL-3R-alpha;IL-3RA;IL3R;IL3RAY;IL3RX;IL3RY;interleukin 3 receptor, alpha (low affinity);interleukin-3 receptor class II alpha chain;interleukin-3 receptor subunit alpha;SUT-;SUT-1
Extra Details:: Enables interleukin-3 binding activity and interleukin-3 receptor activity. Acts upstream of or within interleukin-3-mediated signaling pathway; monocyte differentiation; and regulation of cell growth. Located in membrane. Is expressed in several structur