PE Rabbit anti-Mouse Ly-6A/E (Sca-1) monoclonal antibody

Size

POA

SKU:: A26064
Additional Names:: Ly-6A.2|Ly-6A/E|Ly-6E.1|Sca-1|Sca1|TAP
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNG
Uniprot:: P05533
Synonyms:: Ly-6A;Ly-6A.2;Ly-6A/E;Ly-6E.;Ly-6E.1;lymphocyte antigen 6A-2/6E-1;Sc;Sca;Sca-1;Sca1;stem cell antigen 1;T;T-cell-activating protein;TAP
Extra Details:: T-cell activation.Predicted to enable acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Acts upstream of or within response to bacterium. Located in external side of plasma membrane. Is expressed in alimentary system; hindlimb tendon; liver; metanephros; and physiological umbilical hernia. Used to study osteoporosis. Orthologous to human LY6H (lymphocyte antigen 6 family member H).