PE Rabbit anti-Mouse CD107a/LAMP1 monoclonal antibody

Size

POA

SKU:: A26061
Additional Names:: CD107a|Lamp-1|LGP-120|LGP-A|P2B|Perk
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEE
Uniprot:: P11438
Synonyms:: 120 kDa lysosomal membrane glycoprotein;CD107;CD107 antigen-like family member A;CD107a;Lam;Lamp I;LAMP-1;LAMPA;LGP-120;LGP-A;LGP120;lysosomal membrane glycoprotein 1;lysosomal membrane glycoprotein A;lysosome-associated membrane glycoprotein 1;LYSOSOME-ASSOCIATED MEMBRANE GLYCOPROTEIN 1 PRECURSOR (LAMP-1) (LGP-A) (LGP-120) (CD107A) (P2B);lysosome-associated membrane protein 1;P2B;Pe;Perk
Extra Details:: Enables protein domain specific binding activity. Involved in protein stabilization. Located in several cellular components, including cytoplasmic vesicle; sarcolemma; and vacuole. Is expressed in several structures, including 1-cell stage embryo; central nervous system; craniocervical region bone; extraembryonic component; and gut. Orthologous to human LAMP1 (lysosomal associated membrane protein 1).