PE Rabbit anti-Mouse CD196/CCR6 monoclonal antibody

Size

POA

SKU:: A26056
Additional Names:: CC-CKR-6|CCR-6|Cmkbr6|KY411
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTK
Uniprot:: O54689
Synonyms:: BN-1;C-C chemokine receptor type 6;C-C CKR-6;CC-CKR-6;CCR-6;CD196;chemokine (C-C motif) receptor 6;chemokine (C-C) receptor 6;chemokine receptor-like 3;CKR-L3;CKRL3;Cmkbr;CMKBR6;DCR2;DRY6;G protein-coupled receptor 29;GPR29;GPRCY4;KY411;LARC receptor;seven-transmembrane receptor, lymphocyte, 22;STRL22
Extra Details:: Enables C-C chemokine binding activity and C-C chemokine receptor activity. Involved in several processes, including immune system development; leukocyte migration; and regulation of cell motility. Located in external side of plasma membrane; sperm plasma membrane; and sperm principal piece. Is expressed in several structures, including central nervous system; gut; immune system; male reproductive gland or organ; and retina. Orthologous to human CCR6 (C-C motif chemokine receptor 6).