APC Rabbit anti-Mouse CD138/Syndecan-1 monoclonal antibody

Size

POA

SKU:: A26049
Additional Names:: CD138|CD138/Syndecan-1|Sstn|syn-1|Synd|Synd1
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQTPSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEKEVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPRVEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGATGASQSLLDRKEVLG
Uniprot:: P18828
Synonyms:: AA408134;AA409076;CD138;CD138 antigen;heparan sulfate proteoglycan fibroblast growth factor receptor;SDC;Sstn;Sy;Syn;syn-1;Synd;SYND1;syndecan;syndecan proteoglycan 1;syndecan-1;synstatin
Extra Details:: Predicted to enable identical protein binding activity and protein C-terminus binding activity. Involved in myoblast development. Acts upstream of or within canonical Wnt signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system; egg cylinder; sensory organ; skin; and urinary system. Orthologous to human SDC1 (syndecan 1).