ABflo[R] 488 Conjugated AIF1/IBA1 Rabbit monoclonal antibody

Size

POA

SKU:: A26032
Additional Names:: AIF-1|D17H6S50E|G1|Iba1
Application:: WB, IF
Molecular Weight:: 17kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEET
Uniprot:: O70200, P55008
Synonyms:: AI607846;AIF-1;allograft inflammatory factor 1;D17H6S50;D17H6S50E;G1;Ib;IBA1;interferon gamma responsive transcript;ionized calcium binding adapter molecule 1;ionized calcium-binding adapter molecule 1;IRT-1;IRT1;protein G1;testis specific
Extra Details:: Enables actin filament binding activity and calcium ion binding activity. Involved in several processes, including Rac protein signal transduction; actin filament organization; and ruffle assembly. Acts upstream of or within actin filament bundle assembly. Located in several cellular components, including actin filament; phagocytic cup; and ruffle membrane. Is expressed in adrenal cortex; central nervous system; embryo mesenchyme; and retina. Human ortholog(s) of this gene implicated in type 1 diabetes mellitus. Orthologous to human AIF1 (allograft inflammatory factor 1).