A25997
[KD Validated] AARS2 Rabbit polyclonal antibody

Size
POA
- SKU:
- A25997
- Additional Names:
- AARSL|COXPD8|LKENP|MT-ALARS|MTALARS
- Application:
- ELISA, WB
- Molecular Weight:
- 107kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GLWLDVHALGELQRQGVPPTDDSPKYNYSLRPSGSYEFGTCEAQVLQLYTEDGTAVASVGKGQRCGLLLDRTNFYAEQGGQASDRGYLVRAGQEDVLFPVARAQVCGGFILHEAVAPECLRLGDQVQLHV
- Uniprot:
- Q5JTZ9
- Synonyms:
- AARSL;alanine tRNA ligase 2, mitochondrial (putative);alanine--tRNA ligase, mitochondrial;Alanyl-tRNA synthetase;alanyl-tRNA synthetase 2, mitochondrial (putative);alanyl-tRNA synthetase like;COXPD8;LKENP;MT-ALARS;MTALARS;probable alanyl-tRNA synthetase, mitochondrial
- Extra Details:
- The protein encoded by this gene belongs to the class-II aminoacyl-tRNA synthetase family. Aminoacyl-tRNA synthetases play critical roles in mRNA translation by charging tRNAs with their cognate amino acids. The encoded protein is a mitochondrial enzyme that specifically aminoacylates alanyl-tRNA. Mutations in this gene are a cause of combined oxidative phosphorylation deficiency 8.
- Shipping Conditions:
- Blue Ice
![[KD Validated] AARS2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A25997/A25997_1.jpg)
![[KD Validated] AARS2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A25997/A25997_2.jpg)
![[KD Validated] AARS2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A25997/A25997_N32217_WB_01.jpg)
![[KD Validated] AARS2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A25997/A25997_N32217_WB_02.jpg)