ABflo[R] 488 Rabbit anti-Mouse VISTA PolymAb[R]

Size

£306.00

SKU:: A25973PM
Additional Names:: 4632428N05Rik|Dies1|PD-1H|VISTA
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAA
Uniprot:: Q9D659
Synonyms:: 4632428N05Rik;B7-H5;B7H5;C10orf54;DD1alpha;Death Domain1alpha;Die;Dies1;differentiation of ESCs 1;GI24;PD-1;PD-1H;PDCD1 homolog;platelet receptor GI24;PP2135;sisp-1;SISP1;stress-induced secreted protein-1;V;V-domain Ig suppressor of T cell activation;V-set domain-containing immunoregulatory receptor;V-set immunoregulatory receptor;V-type immunoglobulin domain-containing suppressor of T-cell activation;VISTA
Extra Details:: Predicted to enable endopeptidase activator activity; enzyme binding activity; and identical protein binding activity. Acts upstream of or within several processes, including negative regulation of CD4-positive, alpha-beta T cell proliferation; negative regulation of T cell cytokine production; and positive regulation of BMP signaling pathway. Located in external side of plasma membrane. Is expressed in several structures, including heart; immune system; lung; male reproductive gland or organ; and small intestine lamina propria. Orthologous to human VSIR (V-set immunoregulatory receptor).

Shipping Conditions:: Blue Ice