APC Rabbit anti-Mouse CD278/ICOS monoclonal antibody

Size

POA

SKU:: A25964
Additional Names:: AILIM|CCLP|CRP-1|H4|Ly115
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKL
Uniprot:: Q9WVS0
Synonyms:: activation-inducible lymphocyte immunomediatory molecule;AILIM;CCLP;CD278;CD28 and CTLA-4-like protein;CD28-related protein 1;CRP-1;CVID1;H4;inducible costimulator;inducible T-cell co-stimulator;inducible T-cell costimulator;Ly115
Extra Details:: Predicted to be involved in T cell costimulation; T cell tolerance induction; and cell-cell adhesion. Located in external side of plasma membrane. Is integral component of plasma membrane. Used to study common variable immunodeficiency. Human ortholog(s) of this gene implicated in celiac disease; common variable immunodeficiency; and immunoglobulin alpha deficiency. Orthologous to human ICOS (inducible T cell costimulator).