A25954
CCL17 Rabbit monoclonal antibody
Size
POA
- SKU:
- A25954
- Additional Names:
- A-152E5.3|ABCD-2|SCYA17|TARC
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 10kDa (Full-length protein) /38-40kDa (Recombinant Protein)
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
- Uniprot:
- Q92583
- Synonyms:
- A-152E5.3;ABCD-2;C-C motif chemokine 17;CC chemokine TARC;chemokine (C-C motif) ligand 17;SCYA17;small inducible cytokine subfamily A (Cys-Cys), member 17;small-inducible cytokine A17;T cell-directed CC chemokine;TARC;thymus and activation-regulated chemokine
- Extra Details:
- This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells.
- Shipping Conditions:
- Blue Ice