CD11a Rabbit monoclonal antibody

Size

POA

SKU:: A25929
Additional Names:: (p180)|Cd11a|LFA-1|LFA-1A|Ly-15|Ly-21
Application:: ELISA, Flow Cytometry, WB
Molecular Weight:: 180kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KGKVDLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDLQRRIYAIEGTNRQDL
Uniprot:: P24063
Synonyms:: (p180);alpha L integrin;Cd11;CD11 antigen-like family member A;Cd11a;CDC2L2;CDC2L3;CDK11-p110;CDK11-p46;CDK11-p58;cell division cycle 2-like 2 (PITSLRE proteins);cell division cycle 2-like protein kinase 2;cell division protein kinase 11A;cyclin-dependent kinase 11A;galactosyltransferase-associated protein kinase p58/GTA;integrin alpha-L;leukocyte adhesion glycoprotein LFA-1 alpha chain;leukocyte function-associated molecule 1 alpha chain;LFA;LFA-1;LFA-1A;Ly-1;Ly-15;Ly-2;Ly-21;lymphocyte antigen 15;lymphocyte function associated antigen 1, alpha polypeptide;p58GTA;PITSLRE;PITSLRE B;PITSLRE serine/threonine-protein kinase CDC2L2
Extra Details:: Predicted to enable ICAM-3 receptor activity and cell adhesion molecule binding activity. Involved in cell-cell adhesion. Acts upstream of or within several processes, including activated T cell proliferation; positive regulation of T cell proliferation; and positive regulation of calcium-mediated signaling. Located in cell-cell junction; external side of plasma membrane; and immunological synapse. Is expressed in heart; hemolymphoid system; and vault of skull. Orthologous to human ITGAL (integrin subunit alpha L).

Shipping Conditions:: Blue Ice