A25928
CD252 (OX40 Ligand) Rabbit monoclonal antibody
Size
POA
- SKU:
- A25928
- Additional Names:
- Ath-1|Ath1|CD134L|gp34|OX-40L|Ox40l|Tnlg2b|TXGP1|Txgp1l
- Application:
- ELISA, Flow Cytometry, IF, ICC
- Molecular Weight:
- Refer to figures
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
- Uniprot:
- P43488
- Synonyms:
- Ath;Ath-;Ath-1;Ath1;atherosclerosis 1;CD134;CD134 ligand;CD134L;CD252;glycoprotein Gp34;gp3;GP34;OX-40L;OX4;OX40 antigen ligand;OX40 ligand;Ox40l;OX4OL;tax-transcriptionally activated glycoprotein 1 (34kD);tax-transcriptionally activated glycoprotein 1 ligand;TNLG2B;tumor necrosis factor (ligand) superfamily member 4;tumor necrosis factor ligand 2B;tumor necrosis factor ligand superfamily member 4;tumor necrosis factor superfamily member 4;Txgp;TXGP1;Txgp1l
- Extra Details:
- Enables tumor necrosis factor receptor binding activity. Involved in several processes, including T cell activation; regulation of gene expression; and regulation of lymphocyte activation. Acts upstream of or within cholesterol metabolic process; inflammatory response; and negative regulation of cytokine production. Predicted to be located in cell surface. Predicted to be active in extracellular space. Is expressed in sensory organ and skeleton. Used to study primary pulmonary hypertension and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in myocardial infarction. Orthologous to human TNFSF4 (TNF superfamily member 4).
- Shipping Conditions:
- Blue Ice