Fibronectin Rabbit polyclonal antibody

Size

£152.00

SKU:: A25907
Additional Names:: E330027I09|Fn|Fn-1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 272 kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ALSQTTISWTPFQESSEYIISCQPVGTDEEPLQFQVPGTSTSATLTGLTRGVTYNIIVEALQNQRRHKVREEVVTVGNAVSEGLNQPTDDSCFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYNQRTNTNVNCPIECFMPLDVQADRDDSRE
Uniprot:: P11276
Synonyms:: CIG;cold-insoluble globulin;E330027I09;ED-B;epididymis secretory sperm binding protein;F;fibronectin;FINC;FN;Fn-;Fn-1;FNZ;GFND;GFND2;LETS;migration-stimulating factor;MSF;SMDCF
Extra Details:: Enables peptidase activator activity. Acts upstream of or within several processes, including calcium-independent cell-matrix adhesion; cell-substrate junction assembly; and positive regulation of axon extension. Located in apical plasma membrane and basement membrane. Is expressed in several structures, including alimentary system; cardiovascular system; egg cylinder; embryo mesenchyme; and genitourinary system. Human ortholog(s) of this gene implicated in calcium oxalate nephrolithiasis; membranoproliferative glomerulonephritis; and spondylometaphyseal dysplasia corner fracture type. Orthologous to human FN1 (fibronectin 1).

Shipping Conditions:: Blue Ice