ABflo[R] 488 Rabbit anti-Mouse CD226/DNAM-1 monoclonal antibody

Size

POA

SKU:: A25862
Additional Names:: DNAM-1|DNAM1|Pta1|TLiSA1
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP
Uniprot:: Q8K4F0
Synonyms:: adhesion glycoprotein;BC051526;CD226 antigen;DNA;DNAM;DNAM-1;DNAM1;DNAX accessory molecule-1;platelet and T cell activation antigen 1;Platelet and T-cell activation antigen 1;Pt;PTA1;T lineage-specific activation antigen 1 antigen;TL;TLiSA1
Extra Details:: Predicted to enable integrin binding activity and protein kinase binding activity. Acts upstream of or within positive regulation of interferon-gamma production and positive regulation of natural killer cell cytokine production. Located in external side of plasma membrane. Is expressed in embryo. Orthologous to human CD226 (CD226 molecule).