APC Rabbit anti-Mouse CD121a/IL1R1 monoclonal antibody

Size

POA

SKU:: A25859
Additional Names:: CD121a|CD121b|IL-1R-1|IL-1R-alpha|IL-1R1|IL-1RT-1|IL-1RT1|IL-iR|Il1r-1
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPVPDFK
Uniprot:: P13504
Synonyms:: CD121;CD121 antigen-like family member A;CD121A;CD121b;D2S1473;I;IL-;IL-1 receptor alpha chain;IL-1R-1;IL-1R-alpha;IL-1R1;IL-1RT-1;IL-1RT1;IL-iR;Il1;IL1R;Il1r-1;IL1RA;interleukin 1 receptor alpha, type I;interleukin-1 receptor alpha;interleukin-1 receptor type 1;interleukin-1 receptor type I;P80
Extra Details:: Enables interleukin-1 binding activity; interleukin-1 receptor activity; and protease binding activity. Involved in interleukin-1-mediated signaling pathway. Acts upstream of or within several processes, including cytokine-mediated signaling pathway; positive regulation of interleukin-1-mediated signaling pathway; and positive regulation of neutrophil extravasation. Located in external side of plasma membrane. Is expressed in brain; dorsal aorta; liver; reproductive system; and spleen. Used to study type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in systemic scleroderma and type 1 diabetes mellitus. Orthologous to human IL1R1 (interleukin 1 receptor type 1).

Shipping Conditions:: Blue Ice