A25848
CCL4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A25848
- Additional Names:
- Act-2|AT744.1|MIP-1B|Mip1b|Scya4
- Application:
- ELISA, WB
- Molecular Weight:
- 12kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
- Uniprot:
- P14097
- Synonyms:
- Act-;Act-2;ACT2;AT744.;AT744.1;C-C motif chemokine 4;chemokine (C-C motif) ligand 4;G-26;G-26 T-lymphocyte-secreted protein;HC21;immune activation protein 2;LAG-1;LAG1;lymphocyte activation gene 1 protein;macrophage inflammatory protein 1-beta;Mip;MIP-;MIP-1-beta;MIP-1-beta(1-69);MIP-1B;MIP1B;MIP1B1;PAT 744;Protein H400;Scy;SCYA2;SCYA4;secreted protein G-26;SIS-gamma;small inducible cytokine A4 (homologous to mouse Mip-1b);small-inducible cytokine A4;T-cell activation protein 2
- Extra Details:
- Predicted to enable chemokine receptor binding activity and identical protein binding activity. Acts upstream of or within cellular response to xenobiotic stimulus. Located in extracellular space. Is expressed in central nervous system; genitourinary system; and retina. Human ortholog(s) of this gene implicated in acquired immunodeficiency syndrome and human immunodeficiency virus infectious disease. Orthologous to several human genes including CCL4L2 (C-C motif chemokine ligand 4 like 2).
- Shipping Conditions:
- Blue Ice

