IFN-beta Rabbit monoclonal antibody

Size

POA

SKU:: A25818
Additional Names:: If1da1|Ifb|IFN-beta|IFNB
Application:: ELISA, WB
Molecular Weight:: 24kDa/26kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
Uniprot:: P01575
Synonyms:: fibroblast interferon;If;If1da1;IFB;IFF;IFN-b;IFN-beta;IFNB;interferon 1da1;interferon beta;interferon-beta;interferon, beta 1, fibroblast
Extra Details:: Enables cytokine activity and type I interferon receptor binding activity. Involved in B cell proliferation; cellular response to virus; and type I interferon signaling pathway. Acts upstream of or within several processes, including cellular response to organic cyclic compound; defense response to other organism; and negative regulation of osteoclast differentiation. Located in extracellular space. Is expressed in embryo and liver. Human ortholog(s) of this gene implicated in COVID-19. Orthologous to human IFNB1 (interferon beta 1).