DARPP32 Rabbit polyclonal antibody

Size

£152.00

SKU:: A2580
Additional Names:: DARPP-32|DARPP32
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 34kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGY
Uniprot:: Q9UD71
Synonyms:: DARPP-32;DARPP32;dopamine and cAMP-regulated neuronal phosphoprotein 32;Dopamine- and cAMP-regulated neuronal phosphoprotein;protein phosphatase 1 regulatory subunit 1B
Extra Details:: This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.