B6R Rabbit monoclonal antibody

Size

POA

SKU:: A25795
Application:: ELISA, WB
Molecular Weight:: 40kda
Species Reactivity:: Virus
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Species:: Virus
Sequence:: TCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH
Uniprot:: Q8V4S2
Synonyms:: EEV type-I membrane glycoprotein;MPXV_gp161
Extra Details:: B6R is a host-range protein located on the membrane of the extracellular envelope virion (EEV), homologous to vaccinia virus complement control protein B5, which is involved in the negative regulation of complement activation.