A25755
Lif Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A25755
- Application:
- ELISA, WB
- Molecular Weight:
- 26kDa
- Species Reactivity:
- Mouse
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
- Uniprot:
- P09056
- Synonyms:
- CDF;cholinergic differentiation factor;D factor;DIA;differentiation inhibitory activity;differentiation-inducing factor;differentiation-stimulating factor;hepatocyte-stimulating factor III;HILDA;human interleukin in DA cells;leukemia inhibitory factor;melanoma-derived LPL inhibitor;MLPLI;myeloid leukaemia inhibitory factor
- Extra Details:
- Enables cytokine activity and growth factor activity. Acts upstream of or within several processes, including animal organ development; generation of neurons; and positive regulation of macromolecule metabolic process. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; cranium; early conceptus; and female reproductive system. Orthologous to human LIF (LIF interleukin 6 family cytokine).
- Shipping Conditions:
- Blue Ice

