Lif Rabbit polyclonal antibody

Size

£152.00

SKU:: A25755
Application:: ELISA, WB
Molecular Weight:: 26kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Uniprot:: P09056
Synonyms:: CDF;cholinergic differentiation factor;D factor;DIA;differentiation inhibitory activity;differentiation-inducing factor;differentiation-stimulating factor;hepatocyte-stimulating factor III;HILDA;human interleukin in DA cells;leukemia inhibitory factor;melanoma-derived LPL inhibitor;MLPLI;myeloid leukaemia inhibitory factor
Extra Details:: Enables cytokine activity and growth factor activity. Acts upstream of or within several processes, including animal organ development; generation of neurons; and positive regulation of macromolecule metabolic process. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; cranium; early conceptus; and female reproductive system. Orthologous to human LIF (LIF interleukin 6 family cytokine).