A25752
CD300a Rabbit monoclonal antibody

Size
POA
- SKU:
- A25752
- Additional Names:
- CLM-8|CMRF-35-H9|CMRF-35H|CMRF35-H|CMRF35-H9|CMRF35H|CMRF35H9|IGSF12|IRC1|IRC1/IRC2|IRC2|IRp60
- Application:
- ELISA, Flow Cytometry, WB
- Molecular Weight:
- 40-70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LSKCRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKTSTITTAFPPVSSTTLFAVGATHSASIQEETEEVVNSQ
- Uniprot:
- Q9UGN4
- Synonyms:
- CD300 antigen-like family member A;CD300a antigen;CLM-8;CMRF-35-H9;CMRF-35H;CMRF35-H;CMRF35-H9;CMRF35-like molecule 8;CMRF35H;CMRF35H leukocyte immunoglobulin-like receptor;CMRF35H9;IGSF12;immunoglobulin superfamily member 12;inhibitory receptor protein 60;IRC1;IRC1/IRC2;IRC2;IRp60;leukocyte membrane antigen;NK inhibitory receptor
- Extra Details:
- This gene encodes a member of the CD300 glycoprotein family of cell surface proteins found on leukocytes involved in immune response signaling pathways. This gene is located on chromosome 17 in a cluster with all but one of the other family members. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice





