A2575
MEK6 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2575
- Additional Names:
- MAPKK6|MEK6|MKK6|PRKMK6|SAPKK-3|SAPKK3
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 37 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
- Uniprot:
- P52564
- Synonyms:
- dual specificity mitogen-activated protein kinase kinase 6;MAPK/ERK kinase 6;MAPKK 6;MAPKK6;MEK 6;MEK6;MKK6;PRKMK6;protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6);SAPK kinase 3;SAPKK-3;SAPKK3;stress-activated protein kinase kinase 3
- Extra Details:
- This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines or environmental stress. As an essential component of p38 MAP kinase mediated signal transduction pathway, this gene is involved in many cellular processes such as stress induced cell cycle arrest, transcription activation and apoptosis.
- Shipping Conditions:
- Blue Ice