PE Rabbit anti-Human CD301/CLEC10A monoclonal antibody

Size

POA

SKU:: A25724
Additional Names:: CD301|CLECSF13|CLECSF14|HML|HML2|MGL
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH
Uniprot:: Q8IUN9
Synonyms:: C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 13 (macrophage-derived);C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 14 (macrophage-derived);C-type lectin domain family 10 member A;C-type lectin superfamily member 14;CD301;CLECSF13;CLECSF14;HML;HML2;Macrophage lectin 2;macrophage lectin 2 (calcium dependent);MGL
Extra Details:: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene.

Shipping Conditions:: Blue Ice