PE Rabbit anti-Mouse IgG1 monoclonal antibody

Size

POA

SKU:: A25697
Additional Names:: IgG1
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK
Uniprot:: P01868
Extra Details:: Mouse IgG1 is a subtype of immunoglobulin G antibody that is produced by B cells in response to an antigen. It is the most abundant IgG subtype in the serum and plays a crucial role in the adaptive immune response. Mouse IgG1 is composed of two heavy chains and two light chains, and it is involved in opsonization, complement activation, and antibody-dependent cell-mediated cytotoxicity. It is also involved in the regulation of immune responses, including the activation of T cells and the inhibition of B cell activation. Mouse IgG1 is widely used in research and diagnostic applications, including ELISA, Western blotting, and immunohistochemistry. It is also used in therapeutic applications, such as immunotherapy and vaccine development.

Shipping Conditions:: Blue Ice