PE Rabbit anti-Mouse/Rat CD27 monoclonal antibody

Size

POA

SKU:: A25696
Additional Names:: S152|Tnfrsf7|Tp55
Application:: Flow Cytometry
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR
Uniprot:: P41272
Synonyms:: CD antigen 27;CD27 antigen;CD27L receptor;S15;S152;S152. LPFS2;T cell activation antigen S152;T-cell activation antigen CD27;T14;Tnfr;TNFRSF7;Tp5;Tp55;tumor necrosis factor receptor superfamily member 7;tumor necrosis factor receptor superfamily, member 7
Extra Details:: Predicted to enable cysteine-type endopeptidase inhibitor activity involved in apoptotic process. Involved in negative regulation of apoptotic process and positive regulation of JNK cascade. Acts upstream of or within negative regulation of T cell apoptotic process. Located in external side of plasma membrane. Is expressed in several structures, including femur; hemolymphoid system; intestine; pituitary gland; and reproductive system. Human ortholog(s) of this gene implicated in lymphoproliferative syndrome 2. Orthologous to human CD27 (CD27 molecule).