SREBF2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A25685
Additional Names:: bHLHd2|SREBP-2|SREBP2
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 58kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: NKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILLCVLTFLCLSFNPLTSL
Uniprot:: Q12772
Synonyms:: bHLHd2;class D basic helix-loop-helix protein 2;SREBP-2;SREBP2;sterol regulatory element-binding protein 2;Sterol regulatory element-binding transcription factor 2
Extra Details:: This gene encodes a member of the a ubiquitously expressed transcription factor that controls cholesterol homeostasis by regulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain and binds the sterol regulatory element 1 motif. Alternate splicing results in multiple transcript variants.