A2566
SKP1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2566
- Additional Names:
- EMC19|OCP-II|OCP2|p19A|SKP1|SKP1A|TCEB1L
- Application:
- ELISA, WB
- Molecular Weight:
- 19kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
- Uniprot:
- P63208
- Synonyms:
- cyclin A/CDK2-associated p19;cyclin-A/CDK2-associated protein p19;EMC19;OCP-2;OCP-II;OCP2;organ of Corti protein 2;organ of Corti protein II;p19A;p19skp1;RNA polymerase II elongation factor-like protein;RNA polymerase II elongation factor-like protein OCP2;S-phase kinase-associated protein 1;SIII;SKP1A;TCEB1L;transcription elongation factor B polypeptide 1-like
- Extra Details:
- This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7.
- Shipping Conditions:
- Blue Ice





