TGF beta induced (TGFBI) Rabbit polyclonal antibody

Size

£152.00

SKU:: A2561
Additional Names:: BIGH3|CDB1|CDG2|CDGG1|CSD|CSD1|CSD2|CSD3|EBMD|LCD1|TGF beta induced (TGFBI)
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LPPRERSRLLGDAKELANILKYHIGDEILVSGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA
Uniprot:: Q15582
Synonyms:: beta ig-h3;betaig-h3;BIGH3;CDB1;CDG2;CDGG1;CSD;CSD1;CSD2;CSD3;EBMD;kerato-epithelin;LCD1;RGD-CAP;RGD-containing collagen-associated protein;transforming growth factor beta-induced 68kDa;transforming growth factor-beta-induced protein ig-h3;transforming growth factor, beta-induced, 68kD
Extra Details:: This gene encodes an RGD-containing protein that binds to type I, II and IV collagens. The RGD motif is found in many extracellular matrix proteins modulating cell adhesion and serves as a ligand recognition sequence for several integrins. This protein plays a role in cell-collagen interactions and may be involved in endochondrial bone formation in cartilage. The protein is induced by transforming growth factor-beta and acts to inhibit cell adhesion. Mutations in this gene are associated with multiple types of corneal dystrophy.