[KD Validated] eIF4E Rabbit monoclonal antibody

Size

POA

SKU:: A25608
Additional Names:: AUTS19|CBP|eIF-4E|EIF4E1|EIF4EL1|EIF4F
Application:: ELISA, WB, IF, ICC, IP
Molecular Weight:: 25kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEP
Uniprot:: P06730
Synonyms:: AUTS19;CBP;eIF-4E;eIF-4F 25 kDa subunit;EIF4E1;EIF4EL1;EIF4F;eukaryotic translation initiation factor 4E;eukaryotic translation initiation factor 4E-like 1;mRNA cap-binding protein
Extra Details:: The protein encoded by this gene is a component of the eukaryotic translation initiation factor 4F complex, which recognizes the 7-methylguanosine cap structure at the 5' end of messenger RNAs. The encoded protein aids in translation initiation by recruiting ribosomes to the 5'-cap structure. Association of this protein with the 4F complex is the rate-limiting step in translation initiation. This gene acts as a proto-oncogene, and its expression and activation is associated with transformation and tumorigenesis. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants.