A25601
YBEY Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A25601
- Additional Names:
- C21orf57
- Application:
- ELISA, WB
- Molecular Weight:
- 19kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FHEHLKAGEFPQPDFPDDYNLGDIFLGVEYIFHQCKENEDYNDVLTVTATHGLCHLLGFTHGTEAEWQQMFQKEKAVLDELGRRTGTRLQPLTRGLFGGS
- Uniprot:
- P58557
- Synonyms:
- C21orf57;endoribonuclease YbeY;putative metalloprotease C21orf57;putative ribonuclease;rRNA maturation factor homolog;ybeY metallopeptidase (putative)
- Extra Details:
- This gene encodes a highly conserved metalloprotein. A similar protein in bacteria acts as an endoribonuclease, and is thought to function in ribosomal RNA maturation and ribosome assembly. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice



