A25595
CYP1A1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A25595
- Additional Names:
- AHH|AHRR|CP11|CYP1|CYPIA1|P1-450|P450-C|P450DX
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 58kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTVIGRSRRPRLS
- Uniprot:
- P04798
- Synonyms:
- AHH;AHRR;aryl hydrocarbon hydroxylase;CP11;CYP1;CYPIA1;cytochrome P1-450, dioxin-inducible;cytochrome P450 1A1;cytochrome P450 form 6;cytochrome P450-C;cytochrome P450-P1;cytochrome P450, family 1, subfamily A, polypeptide 1;cytochrome P450, subfamily I (aromatic compound-inducible), polypeptide 1;flavoprotein-linked monooxygenase;hydroperoxy icosatetraenoate dehydratase;P1-450;P450-C;P450DX;xenobiotic monooxygenase
- Extra Details:
- This gene, CYP1A1, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. The gene has been associated with lung cancer risk. A related family member, CYP1A2, is located approximately 25 kb away from CYP1A1 on chromosome 15. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
- Shipping Conditions:
- Blue Ice







