A25583
NFYA Rabbit monoclonal antibody
Size
POA
- SKU:
- A25583
- Additional Names:
- CBF-A|CBF-B|HAP2|NF-YA
- Application:
- ChIP, ELISA, WB, IHC-P, IP
- Molecular Weight:
- 37kDa/43kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDP
- Uniprot:
- P23511
- Synonyms:
- CAAT box DNA-binding protein subunit A;CAAT-box DNA binding protein subunit A;CBF-A;CBF-B;CCAAT-binding transcription factor subunit B;HAP2;HAP2 CCAAT-binding protein;NF-YA;nuclear transcription factor Y subunit A;nuclear transcription factor Y subunit alpha;nuclear transcription factor Y, alpha;Transcription factor NF-Y, A subunit
- Extra Details:
- The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms.
- Shipping Conditions:
- Blue Ice