ZNF20 Rabbit PolymAb[R]

Size

POA

SKU:: A25582PM
Additional Names:: KOX13
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 62kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KVQNIEDEYKNPRRNLSLMREKLCESKESHHCGESFNQIADDMLNRKTLPGITPCESSVCGEVGTGHS
Uniprot:: P17024
Synonyms:: KOX13;zinc finger protein 20;zinc finger protein KOX13
Extra Details:: Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II. Predicted to be located in nucleus.