ABflo[R] 488 Rabbit anti-Mouse CD215/IL-15RA Alpha monoclonal antibody

Size

POA

SKU:: A25573
Additional Names:: Il15ra
Application:: Flow Cytometry, IF, ICC
Molecular Weight:: Refer to figures
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK
Uniprot:: Q60819
Synonyms:: AA690181;CD215;IL-15 receptor subunit alpha;IL-15R-alpha;IL-15RA;interleukin 15 receptor, alpha;interleukin-15 receptor subunit alpha
Extra Details:: Predicted to enable interleukin-15 receptor activity and protein kinase binding activity. Acts upstream of or within positive regulation of natural killer cell differentiation. Located in cytoplasmic vesicle and plasma membrane. Is expressed in central nervous system; retina; retina inner nuclear layer; and retina outer nuclear layer. Orthologous to human IL15RA (interleukin 15 receptor subunit alpha).