Granzyme B Rabbit polyclonal antibody

Size

£152.00

SKU:: A2557
Additional Names:: C11|CCPI|CGL-1|CGL1|CSP-B|CSPB|CTLA1|CTSGL1|Granzyme B|HLP|SECT
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 30kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: YNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFK
Uniprot:: P10144
Synonyms:: C11;cathepsin G-like 1;CCPI;CGL-1;CGL1;CSP-B;CSPB;CTLA-1;CTLA1;CTSGL1;cytotoxic serine protease B;cytotoxic T-lymphocyte proteinase 2;fragmentin 2;Fragmentin-2;granzyme B;granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1);Granzyme-2;HLP;human lymphocyte protein;SECT;T-cell serine protease 1-3E
Extra Details:: This gene encodes a member of the granzyme subfamily of proteins, part of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by natural killer (NK) cells and cytotoxic T lymphocytes (CTLs) and proteolytically processed to generate the active protease, which induces target cell apoptosis. This protein also processes cytokines and degrades extracellular matrix proteins, and these roles are implicated in chronic inflammation and wound healing. Expression of this gene may be elevated in human patients with cardiac fibrosis.

Shipping Conditions:: Blue Ice