ABflo[R] 488 Rabbit anti-Human CD85h/LILRA2 monoclonal antibody

Size

POA

SKU:: A25566
Additional Names:: CD85H|ILT1|LIR-7|LIR7
Application:: Flow Cytometry, IF, ICC
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVEN
Uniprot:: Q8N149
Synonyms:: CD85 antigen-like family member H;CD85H;ILT1;immunoglobulin-like transcript 1;leucocyte Ig-like receptor A2;leukocyte immunoglobulin-like receptor 7;leukocyte immunoglobulin-like receptor subfamily A member 2;leukocyte immunoglobulin-like receptor subfamily A member 2 soluble;leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2;LIR-7;LIR7
Extra Details:: This gene encodes a member of a family of immunoreceptors that are expressed predominantly on monocytes and B cells, and at lower levels on dendritic cells and natural killer cells. The encoded protein is an activating receptor that inhibits dendritic cell differentiation and antigen presentation and suppresses innate immune response. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and there is a pseudogene for this gene on chromosome 3.

Shipping Conditions:: Blue Ice