A2555
cFLIP Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2555
- Additional Names:
- c-FLIP|c-FLIPL|c-FLIPR|c-FLIPS|CASH|CASP8AP1|Casper|cFLIP|CLARP|FLAME|FLAME-1|FLAME1|FLIP|I-FLICE|MRIT
- Application:
- ELISA, WB
- Molecular Weight:
- 28kDa/55kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIP
- Uniprot:
- O15519
- Synonyms:
- c-FLIP;c-FLIPL;c-FLIPR;c-FLIPS;CASH;CASP8 and FADD-like apoptosis regulator;CASP8AP1;caspase homolog;caspase-eight-related protein;caspase-like apoptosis regulatory protein;caspase-related inducer of apoptosis;Casper;cellular FLICE-like inhibitory protein;cFLIP;CLARP;FADD-like antiapoptotic molecule 1;FLAME;FLAME-1;FLAME1;FLIP;I-FLICE;inhibitor of FLICE;MACH-related inducer of toxicity;MRIT;testis secretory sperm-binding protein Li 233m;Usurpin;usurpin beta
- Extra Details:
- The protein encoded by this gene is a regulator of apoptosis and is structurally similar to caspase-8. However, the encoded protein lacks caspase activity and appears to be itself cleaved into two peptides by caspase-8. Several transcript variants encoding different isoforms have been found for this gene, and partial evidence for several more variants exists.
- Shipping Conditions:
- Blue Ice