Galectin 3/LGALS3 Rabbit monoclonal antibody

Size

POA

SKU:: A25538
Additional Names:: CBP35|GAL3|GALBP|GALIG|L31|LGALS2|MAC2
Application:: ELISA, Flow Cytometry, WB, IF, ICC, IP
Molecular Weight:: 28kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Uniprot:: P17931
Synonyms:: 35 kDa lectin;advanced glycation end-product receptor 3;carbohydrate-binding protein 35;CBP35;epididymis secretory sperm binding protein;GAL3;galactose-specific lectin 3;Galactoside-binding protein;GALBP;galectin-3;GALIG;IgE-binding protein;L-31;L31;laminin-binding protein;lectin L-29;lectin, galactoside-binding, soluble, 3;LGALS2;MAC-2 antigen;MAC2
Extra Details:: This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice