ABflo[R] 488 Rabbit anti-Mouse CD205/DEC-205 monoclonal antibody

Size

POA

SKU:: A25530
Additional Names:: CD205|DEC-205|DEC205
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: CEGNWEKNEQIGSCYQFNNQEILSWKEAYVSCQNQGADLLSIHSAAELAYITGKEDIARLVWLGLNQLYSARGWEWSDFRPLKFLNWDPGTPVAPVIGGSSCARMDTESGLWQSVSCESQQPYVCKKPLNNTLELPDVWTYTDTHCHVGWLPNNGFCYLLANESSSWDAAHLKCKAFGADLISMHSLADVEVVVTKLHNGDVKKEIWTGLKNTNSPALFQWSDGTEVTLTYWNENEPSVPFNKTPNCVSYLGKLGQWKVQSCEKKLRYVCKKKGE
Uniprot:: Q60767
Synonyms:: C-type lectin domain family 13 member B;CD205;CLEC13B;DEC-205;DEC-205/DCL-1 fusion;DEC205;gp200-MR6;ly-75;LY75;LY75-CD302 fusion protein;lymphocyte antigen 75
Extra Details:: Predicted to enable signaling receptor activity. Predicted to act upstream of or within endocytosis. Located in external side of plasma membrane. Is expressed in thymus and thymus primordium. Orthologous to several human genes including LY75-CD302 (LY75-CD302 readthrough).