[KO Validated] HMGB1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A2553
Additional Names:: HMG-1|HMG1|HMG3|HMGB1|SBP-1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 29 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKP
Uniprot:: P09429
Synonyms:: Amphoterin;High mobility group protein 1;high mobility group protein B1;high-mobility group (nonhistone chromosomal) protein 1;HMG-1;HMG1;HMG3;SBP-1;Sulfoglucuronyl carbohydrate binding protein
Extra Details:: This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.