ABflo[R] 488 Rabbit anti-Human DNAJB1/HSP40 monoclonal antibody

Size

POA

SKU:: A25527
Additional Names:: Hdj1|Hsp40|HSPF1|RSPH16B|Sis1
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
Uniprot:: P25685
Synonyms:: DnaJ (Hsp40) homolog, subfamily B, member 1;dnaJ homolog subfamily B member 1;dnaJ protein homolog 1;Hdj1;heat shock 40 kDa protein 1;Hsp40;HSPF1;human DnaJ protein 1;radial spoke 16 homolog B;RSPH16B;Sis1
Extra Details:: This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. Alternative splicing results in multiple transcript variants.