CD307b Rabbit monoclonal antibody

Size

POA

SKU:: A25526
Additional Names:: CD307b|FCRH2|IFGP4|IRTA4|SPAP1|SPAP1A|SPAP1B|SPAP1C
Application:: ELISA, Flow Cytometry, WB, IF, ICC
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRD
Uniprot:: Q96LA5
Synonyms:: CD307b;fc receptor homolog 2;Fc receptor-like protein 2;FCRH2;IFGP family protein 4;IFGP4;immune receptor translocation-associated protein 4;immunoglobulin receptor translocation-associated protein 4;immunoglobulin superfamily Fc receptor, gp42;IRTA4;SH2 domain containing phosphatase anchor protein 1;SH2 domain-containing phosphatase anchor protein 1;SPAP1;SPAP1A;SPAP1B;SPAP1C
Extra Details:: This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains one immunoreceptor-tyrosine activation motif and two immunoreceptor-tyrosine inhibitory motifs. This protein may be a prognostic marker for chronic lymphocytic leukemia. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Shipping Conditions:: Blue Ice