ABflo[R] 488 Rabbit anti-Mouse CD72 monoclonal antibody

Size

POA

SKU:: A25518
Additional Names:: CD72c|Ly-19|Ly-32|Ly-m19|Lyb-2
Application:: Flow Cytometry
Molecular Weight:: Refer to figures
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: 2-8[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DSSDTCCPCGWIPYQERCFYISHTLGSLEESQKYCTSLSSKLAAFDEPSKYYYEVSLPSGLEELLDRSKSYWIQMSKKWRQDSDSQSRHCVRIKTYYQKWERTISKCAELHPCICESEAFRFPDGINLN
Uniprot:: P21855
Synonyms:: B-cell differentiation antigen CD72;CD72 antigen;CD72b;CD72c;Ly-1;Ly-19;Ly-3;Ly-32;Ly-m1;Ly-m19;Lyb-;lyb-2;LYB2;lymphocyte antigen 32
Extra Details:: Predicted to enable carbohydrate binding activity and transmembrane signaling receptor activity. Predicted to be located in membrane. Predicted to be integral component of membrane. Predicted to be integral component of plasma membrane. Is expressed in brain; cerebellum external granule cell layer; cerebellum internal granule cell layer; hippocampus; and neocortex. Orthologous to human CD72 (CD72 molecule).