GM-CSF Rabbit monoclonal antibody

Size

POA

SKU:: A25503
Additional Names:: Gm-csf|Gmcsf
Application:: ELISA, WB
Molecular Weight:: 45-60kDa
Species Reactivity:: Rat
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Species:: Rat
Sequence:: TRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK
Uniprot:: P48750
Synonyms:: colony stimulating factor 2 (granulocyte-macrophage);colony-stimulating factor;CSF;Gm-csf;GMCSF;granulocyte macrophage-colony stimulating factor;granulocyte-macrophage colony-stimulating factor;molgramostim;molgramostin;sargramostim
Extra Details:: Enables cytokine activity. Involved in several processes, including cellular response to lipopolysaccharide; macrophage activation; and response to silicon dioxide. Located in extracellular space. Used to study Parkinsonism and myocardial infarction. Biomarker of abdominal aortic aneurysm; interstitial cystitis; and lung disease (multiple). Human ortholog(s) of this gene implicated in acute myeloid leukemia; juvenile myelomonocytic leukemia; neutropenia; pulmonary alveolar proteinosis; and visceral leishmaniasis. Orthologous to human CSF2 (colony stimulating factor 2).