A2544
CYP3A4 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2544
- Additional Names:
- CP33|CP34|CYP3A|CYP3A3|CYP3A4|CYPIIIA3|CYPIIIA4|HLP|NF-25|P450C3|P450PCN1|VDDR3
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 50kDa/60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA
- Uniprot:
- P08684
- Synonyms:
- 1,4-cineole 2-exo-monooxygenase;1,8-cineole 2-exo-monooxygenase;Albendazole monooxygenase;albendazole monooxygenase (sulfoxide-forming);albendazole sulfoxidase;cholesterol 25-hydroxylase;CP33;CP34;CYP3A;CYP3A3;CYPIIIA3;CYPIIIA4;cytochrome P450 3A3;cytochrome P450 3A4;cytochrome P450 HLp;cytochrome P450 NF-25;cytochrome P450-PCN1;cytochrome P450, family 3, subfamily A, polypeptide 4;cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 3;cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4;glucocorticoid-inducible P450;HLP;NF-25;nifedipine oxidase;P450-III, steroid inducible;P450C3;P450PCN1;quinine 3-monooxygenase;taurochenodeoxycholate 6-alpha-hydroxylase;VDDR3
- Extra Details:
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs in use today, including acetaminophen, codeine, cyclosporin A, diazepam, erythromycin, and chloroquine. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist; however, it is now thought that this sequence represents a transcript variant of CYP3A4. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Shipping Conditions:
- Blue Ice






