A2543
Adiponectin Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2543
- Additional Names:
- ACDC|ACRP30|Adiponectin|ADIPQTL1|ADPN|APM-1|APM1|GBP28
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 30 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
- Uniprot:
- Q15848
- Synonyms:
- 30 kDa adipocyte complement-related protein;ACDC;ACRP30;adipocyte complement-related 30 kDa protein;Adipocyte, C1q and collagen domain-containing protein;adiponectin;adipose most abundant gene transcript 1 protein;adipose specific collagen-like factor;ADIPQTL1;ADPN;APM-1;APM1;GBP28;Gelatin-binding protein;gelatin-binding protein 28
- Extra Details:
- This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified.
- Shipping Conditions:
- Blue Ice



