A25429
GnRH1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A25429
- Additional Names:
- GNRH|GRH|LHRH|LNRH
- Application:
- ELISA, WB
- Molecular Weight:
- 12kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
- Uniprot:
- P01148
- Synonyms:
- GNRH;GnRH-associated peptide 1;gonadotropin-releasing hormone 1 (luteinizing-releasing hormone);GRH;leuteinizing-releasing hormone;LHRH;LNRH;luliberin I;Progonadoliberin I;progonadoliberin-1;prolactin release-inhibiting factor
- Extra Details:
- This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism.
- Shipping Conditions:
- Blue Ice